60S ribosomal protein L23 Antibody

  • Contact Vendor

Target rpl23
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym MGC111167, MGC117346, MGC72008,60S ribosomal protein L17,60S ribosomal protein L23, ribosomal protein L23, ribosomal protein L17, rpL17
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L23, MGC111167, MGC117346, MGC72008, rpL17
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV