RPL23A Antibody

  • Contact Vendor

Target RPL23A
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 60S ribosomal protein L23a, FLJ27455, MDA20, melanoma differentiation-associated gene 20, ribosomal protein L23a
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ27455, L23A, MDA20
Company Novus Biologicals
Type Antibody
Immunogen The immunogen for this antibody is RPL23A. Peptide sequence VFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDA