MRPL24 Antibody

  • Contact Vendor

Target mrpl24
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym FLJ20917, L24mt, MGC22737, MGC9831, mitochondrial ribosomal protein L24, mitochondrial, MRP-L24, MRP-L18
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ20917, L24mt, MGC22737, MGC9831, MRP-L18, MRP-L24
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to MRPL24(mitochondrial ribosomal protein L24) The peptide sequence was selected from the N terminal of MRPL24. Peptide sequence RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG