RPL26L1 Antibody

  • Contact Vendor

Target RPL26L1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ46904, ribosomal protein L26 homolog, ribosomal protein L26 pseudogene 1, ribosomal protein L26-like 1, RPL26P1,60S ribosomal protein L26-like 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ46904, RPL26P1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHV