MRPL41 Antibody

  • Contact Vendor

Target mrpl41
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym Bcl-2-interacting mitochondrial ribosomal protein L41,39S ribosomal protein L41, mitochondrial, BMRPMRP-L41, Cell proliferation-inducing gene 3 protein, mitochondrial ribosomal protein L41,39S ribosomal protein L27 homolog, MRP-L27, MRPL27L41mt, PIG3, proliferation-inducing gene 3, RPML27MRP-L27 homolog
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases BMRP, MRP-L27, MRPL27, RPML27
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL