MRPL28 Antibody

  • Contact Vendor

Target MRPL28
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym L28mt, MAAT139S ribosomal protein L28, mitochondrial, Melanoma antigen p15, melanoma-associated antigen recognised by cytotoxic T lymphocytes, Melanoma-associated antigen recognized by T lymphocytes, MGC8499, mitochondrial ribosomal protein L28, MRP-L28, p15
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MAAT1, MGC8499, p15
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ