MRPL28 Antibody

  • Contact Vendor

Target MRPL28
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym L28mt, MAAT139S ribosomal protein L28, mitochondrial, Melanoma antigen p15, melanoma-associated antigen recognised by cytotoxic T lymphocytes, Melanoma-associated antigen recognized by T lymphocytes, MGC8499, mitochondrial ribosomal protein L28, MRP-L28, p15
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MAAT1, MGC8499, p15
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to MRPL28(mitochondrial ribosomal protein L28) The peptide sequence was selected from the middle region of MRPL28. Peptide sequence EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK