RPL30 Antibody

  • Contact Vendor

Target RPL30
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 60S ribosomal protein L30, ribosomal protein L30
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases L30
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPL30(ribosomal protein L30) The peptide sequence was selected from the middle region of RPL30. Peptide sequence MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE