RPL32 Antibody

  • Contact Vendor

Target rpl32
Species Cross Reactivity Oryctolagus cuniculus, Mus musculus, Danio rerio, Homo sapiens, Xenopus laevis
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym M, ribosomal protein L32,60S ribosomal protein L32
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases L32
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the N terminal of human RPL32. Peptide sequence AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG