RPL34 Antibody

  • Contact Vendor

Target RPL34
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym leukemia-associated protein, M, MGC111005, ribosomal protein L34,60S ribosomal protein L34
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L34, MGC111005
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRG