mitochondrial ribosomal protein L35 Antibody

  • mitochondrial ribosomal protein L35 Antibody

    CatalogueID : NBP1-92119

  • Contact Vendor

Target MRPL35
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym L35mt, mitochondrial ribosomal protein L35, MRP-L35,39S ribosomal protein L35, mitochondrial
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L35mt, MRP-L35
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYF