MRPL36 Antibody

  • Contact Vendor

Target mrpl36
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym BRCA1-interacting protein 1, BRIP1MGC104245, L36mtMRP-L36PRPL36, mitochondrial ribosomal protein L36,39S ribosomal protein L36, mitochondrial, putative BRCA1-interacting protein, RPMJ
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases BRIP1, L36mt, MGC104245, MRP-L36, PRPL36, RPMJ
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM