RPL37 Antibody

  • Contact Vendor

Target RPL37
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp686G1699, G1.16, MGC99572,60S ribosomal protein L37,60S ribosomal protein L37a, ribosomal protein L37
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp686G1699, L37, MGC99572
Company Novus Biologicals
Type Antibody
Immunogen The immunogen for this antibody is RPL37. Peptide sequence PAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRA