MRPL37 Antibody

  • Contact Vendor

Target MRPL37
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym 39S ribosomal protein L2, mitochondrial, L2mt, L37mt, MGC878, mitochondrial ribosomal protein L37, MRP-L2MRPL2, MRP-L37, ribosomal protein, mitochondrial, L2, RPML239S ribosomal protein L37, mitochondrial
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L37mt, MGC878, MRP-L2, MRP-L37, MRPL2, RPML2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP