MRPL38 Antibody

  • Contact Vendor

Target MRPL38
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym FLJ13996, HSPC262, KIAA1863, L38MT, L38mt, MGC4810, mitochondrial ribosomal protein L38,39S ribosomal protein L38, mitochondrial, MRP-L3, MRP-L38, RPML3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ13996, KIAA1863, L38MT, MGC4810, MRP-L3, MRP-L38, RPML3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRL