MRPL39 Antibody

  • Contact Vendor

Target mrpl39
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym C21orf92PRED66, FLJ20451,39S ribosomal protein L39, mitochondrial, L39mt39S ribosomal protein L5, mitochondrial, MGC104174, MGC3400, mitochondrial ribosomal protein L39, MRP-L5L5mt, MRPL5MSTP003, PRED22, RPML5MRP-L39
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C21orf92, FLJ20451, L39mt, MGC104174, MGC3400, MRP-L5, MRPL5, PRED22, PRED66, RPML5
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKAT