RPL4 Antibody

  • Contact Vendor

Target rpl4
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym ribosomal protein L4,60S ribosomal protein L1,60S ribosomal protein L4, RPL1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPT