RPL5 Antibody

  • Contact Vendor

Target rpl5
Species Cross Reactivity Plant (Species unspecified), Oryctolagus cuniculus, Rattus norvegicus, Drosophila melanogaster, Mus musculus, Danio rerio, Bos taurus, Gallus gallus, Homo sapiens, Xenopus laevis
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DBA6,60S ribosomal protein L5, MGC117339, ribosomal protein L5
Unit 0.05 mg
Format Affinity purified
Concentration LYOPH
NCBI Gene Aliases DBA6, L5, MGC117339
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPL5(ribosomal protein L5) The peptide sequence was selected from the N terminal of RPL5 (NP_000960). Peptide sequence RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP