RPL7L1 Antibody

  • Contact Vendor

Target RPL7L1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym dJ475N16.4,60S ribosomal protein L7-like 1, MGC62004, ribosomal protein L7-like 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC62004, dJ475N16.4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KGLRFKRLESFLHDSWRQKRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLV