RPL8 Antibody

  • Contact Vendor

Target RPL8
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Danio rerio, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym ribosomal protein L8,60S ribosomal protein L8
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases L8
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPL8(ribosomal protein L8) The peptide sequence was selected from the C terminal of RPL8. Peptide sequence KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM