RPL9 Antibody

  • Contact Vendor

Target rpl9
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym DKFZp313J1510, FLJ27456, MGC15545, NPC-A-16, ribosomal protein L9,60S ribosomal protein L9, RPL9P7, RPL9P8, RPL9P9
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp313J1510, FLJ27456, L9, MGC15545, NPC-A-16
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE