RPL9 Antibody

  • Contact Vendor

Target rpl9
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp313J1510, FLJ27456, MGC15545, NPC-A-16, ribosomal protein L9,60S ribosomal protein L9, RPL9P7, RPL9P8, RPL9P9
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases DKFZp313J1510, FLJ27456, L9, MGC15545, NPC-A-16
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPL9 (ribosomal protein L9) The peptide sequence was selected from the C terminal of RPL9. Peptide sequence ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE