MRPS10 Antibody

  • Contact Vendor

Target MRPS10
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym 28S ribosomal protein S10, mitochondrial, FLJ10567, mitochondrial 28S ribosomal protein S10, mitochondrial ribosomal protein S10, MRP-S10, PNAS-122, S10mt
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ10567, MRP-S10, PNAS-122
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEE