MRPS12 Antibody

  • Contact Vendor

Target MRPS12
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 28S ribosomal protein S12, mitochondrial, mitochondrial ribosomal protein S12, MPR-S12, MRP-S12, MT-RPS12, ribosomal protein, mitochondrial, S12, RPMS12, RPS12, RPSM12S12mt
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MPR-S12, MT-RPS12, RPMS12, RPS12, RPSM12
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to MRPS12(mitochondrial ribosomal protein S12) The peptide sequence was selected from the N terminal of MRPS12. Peptide sequence LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK