MRPS34 Antibody

  • Contact Vendor

Target Mrps34
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym MGC2616, mitochondrial ribosomal protein S34, MRPS12, MRP-S12,28S ribosomal protein S34, mitochondrial, MRP-S34, S34mt
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC2616, MRP-S12, MRP-S34, MRPS12
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT