RPS13 Antibody

  • Contact Vendor

Target rps13
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ribosomal protein S13,40S ribosomal protein S13
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases S13
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPS13 (ribosomal protein S13) The peptide sequence was selected from the middle region of RPS13. Peptide sequence ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES