RPS14 Antibody

  • Contact Vendor

Target rps14
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Drosophila melanogaster, Mus musculus, Danio rerio, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym emetine resistance, EMTB40S ribosomal protein S14, ribosomal protein S14
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases EMTB, S14
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPS14 (ribosomal protein S14) The peptide sequence was selected from the middle region of RPS14. Peptide sequence GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL