MRPS15 Antibody

  • Contact Vendor

Target mRpS15
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym FLJ11564,28S ribosomal protein S15, mitochondrial, mitochondrial ribosomal protein S15, MPR-S15, MRP-S15, S15mt, RPMS15
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ11564, MPR-S15, RPMS15, S15mt
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDS