RPS15A Antibody

  • Contact Vendor

Target RPS15A
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 40S ribosomal protein S15a, FLJ27457, MGC111208, ribosomal protein S15a, S15a, up-regulated by HBV X protein
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ27457, MGC111208, S15a
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPS15A(ribosomal protein S15a) The peptide sequence was selected from the middle region of RPS15A. Peptide sequence KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH