RPS16 Antibody

  • Contact Vendor

Target rps16
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Danio rerio, Bos taurus, Homo sapiens, Xenopus laevis
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym ribosomal protein S16,40S ribosomal protein S16
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases S16
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the N terminal of human RPS16. Peptide sequence SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL