RPS21 Antibody

  • Contact Vendor

Target RpS21
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ribosomal protein S21,40S ribosomal protein S21,8.2 kDa differentiation factor
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases S21
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPS21 (ribosomal protein S21) The peptide sequence was selected from the middle region of RPS21. Peptide sequence NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF