RPS24 Antibody

  • Contact Vendor

Target RPS24
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DBA3,40S ribosomal protein S24, DKFZp686N1586, ribosomal protein S24
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DBA3, DKFZp686N1586, S24
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPS24(ribosomal protein S24) The peptide sequence was selected from the middle region of RPS24. Peptide sequence GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT