RPS24 Antibody

  • Contact Vendor

Target RPS24
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym DBA3,40S ribosomal protein S24, DKFZp686N1586, ribosomal protein S24
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DBA3, DKFZp686N1586, S24
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMK