MRPS24 Antibody

  • Contact Vendor

Target MRPS24
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym 28S ribosomal protein S24, mitochondrial, bMRP47, bMRP-47, mitochondrial 28S ribosomal protein S24, mitochondrial ribosomal protein S24, MRP-S24HSPC335, S24mt
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MRP-S24, S24mt, bMRP-47, bMRP47
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY