RPS25 Antibody

  • Contact Vendor

Target RPS25
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym ribosomal protein S25,40S ribosomal protein S25
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases S25
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA