MRPS25 Antibody

  • Contact Vendor

Target Mrps25
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym FLJ00023, mitochondrial 28S ribosomal protein S25, mitochondrial ribosomal protein S25, MRP-S2528S ribosomal protein S25, mitochondrial, RPMS25DKFZp313H0817, S25mt
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp313H0817, FLJ00023, MRP-S25, RPMS25
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD