MRPS26 Antibody

  • Contact Vendor

Target MRPS26
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym C20orf193, dJ534B8.3, GI008,28S ribosomal protein S13, mitochondrial, mitochondrial ribosomal protein S26, MRP-S13MRPS13, MRP-S26chromosome 20 open reading frame 193, NY-BR-87, S13mt, RPMS1328S ribosomal protein S26, mitochondrial, S26mt, serologically defined breast cancer antigen NY-BR-87
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C20orf193, GI008, MRP-S13, MRP-S26, MRPS13, NY-BR-87, RPMS13, dJ534B8.3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS