MRPS28 Antibody

  • Contact Vendor

Target MRPS28
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym 28S ribosomal protein S35, mitochondrial, FLJ22853, mitochondrial 28S ribosomal protein S35, mitochondrial ribosomal protein S28, MRP-S2828S ribosomal protein S28, mitochondrial, MRP-S35, MRPS35HSPC007, S28mt, S35mt
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ22853, MRP-S28, MRP-S35, MRPS35
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQM