MRPS35 Antibody

  • Contact Vendor

Target MRPS35
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym 28S ribosomal protein S28, mitochondrial, DKFZp762P093, MDS023,28S ribosomal protein S35, mitochondrial, MGC104278, mitochondrial ribosomal protein S28, mitochondrial ribosomal protein S35, MRP-S28, MRPS28S35mt, MRP-S35, S28mt
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp762P093, MDS023, MGC104278, MRP-S28, MRPS28
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK