RPS4Y1 Antibody

  • Contact Vendor

Target RPS4Y1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym 40S ribosomal protein S4, Y isoform 1, MGC119100, MGC5070, ribosomal protein S4, Y-linked 1,40S ribosomal protein S4, Y, Y-linked
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC119100, MGC5070, RPS4Y, S4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVA