RPS6KC1 Antibody

  • Contact Vendor

Target RPS6KC1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 2.7.11.1, humS6PKh1, ribosomal protein S6 kinase delta-1, ribosomal protein S6 kinase, 52kD, polypeptide 1,52 kDa ribosomal protein S6 kinase, ribosomal protein S6 kinase, 52kDa, polypeptide 1, Ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein, RPK118, S6K-delta-1, SPHK1-binding protein
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RPK118, humS6PKh1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISKFLNRSPEESFDIKEVKKPTLAKVHLQQPTSSPQDSSSFESRGSDGGSMLKALPLKSSLTPSSQDD