S6K Antibody

  • Contact Vendor

Target RPS6KB1
Species Cross Reactivity Mus musculus, Rattus norvegicus
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target/Molecule Synonym EC 2.7.11, EC, p70 S6KA, p70 S6K-alpha, p70(S6K)-alpha, p70-alpha, p70-S6K, P70S6K1, p70 ribosomal S6 kinase alpha, p70 S6 kinase alpha, p70 S6 kinase, alpha 1,70 kDa ribosomal protein S6 kinase 1, p70 S6 kinase, alpha 2, PS6K, ribosomal protein S6 kinase beta-1, Ribosomal protein S6 kinase I, ribosomal protein S6 kinase, 70kD, polypeptide 1, ribosomal protein S6 kinase, 70kDa, polypeptide 1, S6K, S6K1p70-S6K 1, S6K-beta-1, serine/threonine kinase 14 alpha, Serine/threonine-protein kinase 14A, STK14A
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
NCBI Gene Aliases PS6K,S6K,S6K1,STK14A,p70(S6K)-alpha,p70-S6K,p70-alph
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to RPS6KB1(ribosomal protein S6 kinase, 70kDa, polypeptide 1) The peptide sequence was selected from the N terminal of RPS6KB1. Peptide sequence KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF.
Gene Name ribosomal protein S6 kinase, 70kDa, polypeptide 1
Uniprot ID P67998