RSK2 Antibody

  • Contact Vendor

Target RPS6KA3
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym 90 kDa ribosomal protein S6 kinase 3, Coffin-Lowry syndrome, CLS, EC 2.7.11, EC 2.7.11.1, HU-3, Insulin-stimulated protein kinase 1, ISPK1, ISPK-1, MAP kinase-activated protein kinase 1b, MAPKAPK1B, MAPKAPK-1b, MAPK-activated protein kinase 1b, MAPKAP kinase 1b, mental retardation, X-linked 19, MRX19, p90-RSK2, p90RSK3, pp90RSK2, ribosomal protein S6 kinase alpha-3, ribosomal protein S6 kinase, 90kDa, polypeptide 3, Ribosomal S6 kinase 2, ribosomal protein S6 kinase, 90kD, polypeptide 3, RSK, RSK-2, RSK2p90-RSK 3, S6K-alpha3, S6K-alpha-3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CLS, HU-3, ISPK-1, MAPKAPK1B, MRX19, RSK, RSK2, S6K-alpha3, p90-RSK2, pp90RSK2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY