RPS6KL1 Antibody

  • Contact Vendor

Target RPS6KL1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 2.7.11.1, FLJ35734, MGC11287, ribosomal protein S6 kinase-like 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ35734, MGC11287
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SQAHVYLEQIRNRVALGVPDMTKRDYLVDAATQIRLALERDVSEDYEAAFNHYQNGVDVLLRGIHVDPNKERRE