MRPS7 Antibody

  • Contact Vendor

Target mrps7
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym bMRP27a, bMRP-27a, mitochondrial ribosomal protein S7, MRP-S, MRP-S7,30S ribosomal protein S7 homolog, RPMS7,28S ribosomal protein S7, mitochondrial, RP-S7, S7mt
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MRP-S, MRP-S7, RP-S7, RPMS7, S7mt, bMRP27a
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW