RPS8 Antibody

  • Contact Vendor

Target rps8
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym OK/SW-cl.83, ribosomal protein S8,40S ribosomal protein S8
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases S8
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGK