67kDa Laminin Receptor Antibody

  • Contact Vendor

Target rpsA
Species Cross Reactivity Sus scrofa, Oryctolagus cuniculus, Rattus norvegicus, Mus musculus, Danio rerio, Bos taurus, Gallus gallus, Homo sapiens, Xenopus laevis
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym 67 kDa laminin receptor, 67kD, ribosomal protein SA, 67LR, 37 kDa laminin receptor precursor, 37/67 kDa laminin receptor, 37LRPNEM/1CHD4, Colon carcinoma laminin-binding protein, laminin binding protein, Laminin receptor 1, laminin receptor 1 (67kD, ribosomal protein SA), LAMBR37 kDa laminin receptor, LAMR140S ribosomal protein SA, LBP, LBP/p40, Laminin-binding protein precursor p40, lamR, LamR, LAMR 1, LRP, LRP/LR, Multidrug resistance-associated protein MGr1-Ag, p40, ribosomal protein SA
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases 37LRP, 67LR, LAMBR, LAMR1, LBP, LRP, SA, p40
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPSA(ribosomal protein SA) The peptide sequence was selected from the middle region of RPSA (NP_002286). Peptide sequence TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY