RPLP0 Antibody

  • Contact Vendor

Target rplP0
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym 60S acidic ribosomal protein P0, 60S ribosomal protein L10E, acidic ribosomal phosphoprotein P0, L10E, MGC111226, MGC88175, P0, PRLP0, ribosomal protein, large, P0, RPP0
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases L10E, LP0, MGC111226, MGC88175, P0, PRLP0, RPP0
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGIT