RPLP0 Antibody

  • Contact Vendor

Target rplP0
Species Cross Reactivity Canis lupus familiaris, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 60S acidic ribosomal protein P0, 60S ribosomal protein L10E, acidic ribosomal phosphoprotein P0, L10E, MGC111226, MGC88175, P0, PRLP0, ribosomal protein, large, P0, RPP0
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases L10E, LP0, MGC111226, MGC88175, P0, PRLP0, RPP0
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPLP0(ribosomal protein, large, P0) The peptide sequence was selected from the middle region of RPLP0. Peptide sequence PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY