RRP1 Antibody

  • Contact Vendor

Target Rrp1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym D21S2056ENop52, NOP52protein NNP-1, NNP1, NNP-1Nnp1 homolog, nucleolar protein, Novel nuclear protein 1, Nucleolar protein Nop52, ribosomal RNA processing 1 homolog (S. cerevisiae), RRP1Aribosomal RNA processing protein 1 homolog A, RRP1-like protein
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases D21S2056E, NNP-1, NOP52, RRP1A
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GSICRAEPEAGEEQAGDDRDSGGPVLQFDYEAVANRLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFPEDEIPEKACRRLLEGRRQKK